Lineage for d1b4ad2 (1b4a D:79-149)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33483Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 33516Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) (S)
  5. 33517Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
  6. 33518Protein C-terminal domain of arginine repressor [55254] (2 species)
  7. 33519Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)
  8. 33526Domain d1b4ad2: 1b4a D:79-149 [39724]
    Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1

Details for d1b4ad2

PDB Entry: 1b4a (more details), 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus

SCOP Domain Sequences for d1b4ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ad2 d.74.2.1 (D:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

SCOP Domain Coordinates for d1b4ad2:

Click to download the PDB-style file with coordinates for d1b4ad2.
(The format of our PDB-style files is described here.)

Timeline for d1b4ad2: