SCOP 1.55: Domain d1b4ac1: 1b4a C:4-78

Lineage for d1b4ac1 (1b4a C:4-78)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families)

5. Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)

6. Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [46795] (1 PDB entry)

8. Domain d1b4ac1: 1b4a C:4-78 [16090]
   Other proteins in same PDB: d1b4aa2, d1b4ab2, d1b4ac2, d1b4ad2, d1b4ae2, d1b4af2

Details for d1b4ac1

PDB Entry: 1b4a, 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus

SCOP Domain Sequences for d1b4ac1:

Sequence; same for both SEQRES and ATOM records:

>d1b4ac1 a.4.5.3 (C:4-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus stearothermophilus}
gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
lpsdqrfnplqklkr

Timeline for d1b4ac1:

• d1b4ac1 appears in SCOP 1.57
  
• d1b4ac1 appears in the current release, SCOPe 2.08