Lineage for d6lhgd2 (6lhg D:179-270)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754118Domain d6lhgd2: 6lhg D:179-270 [395229]
    Other proteins in same PDB: d6lhga1, d6lhga3, d6lhgd1, d6lhgd3
    automated match to d1t7va1

Details for d6lhgd2

PDB Entry: 6lhg (more details), 2.8 Å

PDB Description: crystal structure of chicken ccd8aa/pbf2*04:01
PDB Compounds: (D:) MHC class I alpha chain 2

SCOPe Domain Sequences for d6lhgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lhgd2 b.1.1.0 (D:179-270) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rerpevrvwgkeadgiltlscrahgfyprpivvswlkdgavrgqdahsggivpngdgtyh
twvtieaqpgdgdkyqcrvehaslpqpglysw

SCOPe Domain Coordinates for d6lhgd2:

Click to download the PDB-style file with coordinates for d6lhgd2.
(The format of our PDB-style files is described here.)

Timeline for d6lhgd2: