Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins) PfamB PB001946 |
Protein automated matches [384919] (1 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384920] (27 PDB entries) |
Domain d7kf4d2: 7kf4 D:191-346 [394968] Other proteins in same PDB: d7kf4a1, d7kf4a3, d7kf4b1, d7kf4b3, d7kf4c1, d7kf4c3, d7kf4d1, d7kf4d3, d7kf4e1, d7kf4e3, d7kf4f1, d7kf4f3 automated match to d2h85a2 complexed with cit |
PDB Entry: 7kf4 (more details), 2.61 Å
SCOPe Domain Sequences for d7kf4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kf4d2 d.294.1.2 (D:191-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsvvskvvkvtidyteisfmlwckdghvetfypklq
Timeline for d7kf4d2: