SCOPe 2.07: Structural Classification of Proteins

PDB entry 7kf4

View 7kf4 on RCSB PDB site
Description: Crystal structure from SARS-CoV-2 NendoU NSP15
Class: viral protein, hydrolase
Keywords: NSP15, NendoU, covid-19, covid, sars, sars-cov-2, endoribonuclease, VIRAL PROTEIN, HYDROLASE
Deposited on 2020-10-13, released 2020-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-12-02, with a file datestamp of 2020-11-27.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (3-348)
  - expression tag (1-2)
Domains in SCOPe 2.07: d7kf4a1, d7kf4a2, d7kf4a3
Chain 'B':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (3-348)
  - expression tag (1-2)
Domains in SCOPe 2.07: d7kf4b1, d7kf4b2, d7kf4b3
Chain 'C':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (3-348)
  - expression tag (1-2)
Domains in SCOPe 2.07: d7kf4c1, d7kf4c2, d7kf4c3
Chain 'D':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (3-348)
  - expression tag (1-2)
Domains in SCOPe 2.07: d7kf4d1, d7kf4d2, d7kf4d3
Chain 'E':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (3-348)
  - expression tag (1-2)
Domains in SCOPe 2.07: d7kf4e1, d7kf4e2, d7kf4e3
Chain 'F':
Compound: Uridylate-specific endoribonuclease
Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
Gene: rep, 1a-1b
Database cross-references and differences (RAF-indexed):
- Uniprot P0DTD1 (3-348)
  - expression tag (1-2)
Domains in SCOPe 2.07: d7kf4f1, d7kf4f2, d7kf4f3
Heterogens: CIT, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>7kf4A (A:)
gamslenvafnvvnkghfdgqqgevpvsiinntvytkvdgvdvelfenkttlpvnvafel
wakrnikpvpevkilnnlgvdiaantviwdykrdapahistigvcsmtdiakkptetica
pltvffdgrvdgqvdlfrnarngvlitegsvkglqpsvgpkqaslngvtligeavktqfn
yykkvdgvvqqlpetyftqsrnlqefkprsqmeidflelamdefieryklegyafehivy
gdfshsqlgglhlliglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidl
llddfveiiksqdlsvvskvvkvtidyteisfmlwckdghvetfypklq