Lineage for d7kf4d1 (7kf4 D:1-190)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501848Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins)
    rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain
  6. 2501865Protein automated matches [381979] (2 species)
    not a true protein
  7. 2501869Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382217] (33 PDB entries)
  8. 2501934Domain d7kf4d1: 7kf4 D:1-190 [394967]
    Other proteins in same PDB: d7kf4a2, d7kf4a3, d7kf4b2, d7kf4b3, d7kf4c2, d7kf4c3, d7kf4d2, d7kf4d3, d7kf4e2, d7kf4e3, d7kf4f2, d7kf4f3
    automated match to d2rhba1
    complexed with cit

Details for d7kf4d1

PDB Entry: 7kf4 (more details), 2.61 Å

PDB Description: crystal structure from sars-cov-2 nendou nsp15
PDB Compounds: (D:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d7kf4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kf4d1 c.66.1.48 (D:1-190) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
slenvafnvvnkghfdgqqgevpvsiinntvytkvdgvdvelfenkttlpvnvafelwak
rnikpvpevkilnnlgvdiaantviwdykrdapahistigvcsmtdiakkpteticaplt
vffdgrvdgqvdlfrnarngvlitegsvkglqpsvgpkqaslngvtligeavktqfnyyk
kvdgvvqqlp

SCOPe Domain Coordinates for d7kf4d1:

Click to download the PDB-style file with coordinates for d7kf4d1.
(The format of our PDB-style files is described here.)

Timeline for d7kf4d1: