Lineage for d7k39b_ (7k39 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040945Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries)
  8. 3041008Domain d7k39b_: 7k39 B: [394733]
    Other proteins in same PDB: d7k39a_, d7k39c_, d7k39e_, d7k39g1, d7k39g2, d7k39h_, d7k39i1, d7k39i2, d7k39j_, d7k39k1, d7k39k2, d7k39l_
    automated match to d4d00d_
    complexed with nag

Details for d7k39b_

PDB Entry: 7k39 (more details), 3 Å

PDB Description: structure of full-length influenza ha with a head-binding antibody at ph 5.2, conformation a, neutral ph-like
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d7k39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k39b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d7k39b_:

Click to download the PDB-style file with coordinates for d7k39b_.
(The format of our PDB-style files is described here.)

Timeline for d7k39b_: