SCOPe 2.08: Domain d7k39k1: 7k39 K:2-110

Lineage for d7k39k1 (7k39 K:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7k39k1: 7k39 K:2-110 [395055]
   Other proteins in same PDB: d7k39a_, d7k39b_, d7k39c_, d7k39d_, d7k39e_, d7k39f_
   automated match to d4ocrl1
   complexed with nag

Details for d7k39k1

PDB Entry: 7k39, 3 Å

PDB Description: structure of full-length influenza ha with a head-binding antibody at ph 5.2, conformation a, neutral ph-like

PDB Compounds: (K:) antibody fab light chain

SCOPe Domain Sequences for d7k39k1:

Sequence, based on SEQRES records:

>d7k39k1 b.1.1.0 (K:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgsssnigagyavhwyqqlpgtapkllisgnsnrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltv

Sequence, based on observed residues (ATOM records):

>d7k39k1 b.1.1.0 (K:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgssavhwyqqlpgtapkllisgnsnrpsgvpdrfsgsk
sgtsaslaitglqaedeadyycqssvfgggtkltv

Timeline for d7k39k1:

• d7k39k1 first appeared in SCOPe 2.07