Lineage for d1hnxj_ (1hnx J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953733Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2953734Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2953735Protein Ribosomal protein S10 [55001] (2 species)
  7. 2953761Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 2953777Domain d1hnxj_: 1hnx J: [39334]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxj_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1hnxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d1hnxj_:

Click to download the PDB-style file with coordinates for d1hnxj_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxj_: