Lineage for d1hnxj_ (1hnx J:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) 
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) Protein Ribosomal protein S10 [55001] (1 species) Species Thermus thermophilus [TaxId:274] [55002] (6 PDB entries) 
Domain d1hnxj_: 1hnx J: [39334]
Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
Details for d1hnxj_
PDB Entry: 1hnx (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
SCOP Domain Sequences for d1hnxj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
SCOP Domain Coordinates for d1hnxj_:
Click to download the PDB-style file with coordinates for d1hnxj_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnxj_:
- d1hnxj_ appears in SCOP 1.57
- d1hnxj_ appears in the current release, SCOPe 2.08
View in 3D
