SCOPe 2.08: Domain d1hnxs_: 1hnx S:

Lineage for d1hnxs_ (1hnx S:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)
   automatically mapped to Pfam PF00203

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d1hnxs_: 1hnx S: [38455]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxt_, d1hnxv_
   complexed with mg, pcy, zn

Details for d1hnxs_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1hnxs_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1hnxs_:

• d1hnxs_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxs_ appears in SCOPe 2.07