Lineage for d6uzv6_ (6uzv 6:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026109Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 3026110Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 3026117Protein automated matches [236583] (4 species)
    not a true protein
  7. 3026120Species Synechocystis sp. [TaxId:1111708] [347847] (2 PDB entries)
  8. 3026123Domain d6uzv6_: 6uzv 6: [392499]
    Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv7_, d6uzv8_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvk_, d6uzvl_
    automated match to d4kt0f_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv6_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (6:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6uzv6_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzv6_ f.23.16.1 (6:) automated matches {Synechocystis sp. [TaxId: 1111708]}
dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
vgeytsgklvmkdseiptspr

SCOPe Domain Coordinates for d6uzv6_:

Click to download the PDB-style file with coordinates for d6uzv6_.
(The format of our PDB-style files is described here.)

Timeline for d6uzv6_: