SCOPe 2.08: Domain d6uzv3_: 6uzv 3:

Lineage for d6uzv3_ (6uzv 3:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein automated matches [236563] (10 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [347566] (2 PDB entries)

8. Domain d6uzv3_: 6uzv 3: [392539]
   Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzv8_, d6uzva_, d6uzvb_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvk_, d6uzvl_
   automated match to d5oy0c_
   complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv3_

PDB Entry: 6uzv, 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex

PDB Compounds: (3:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6uzv3_:

Sequence; same for both SEQRES and ATOM records:

>d6uzv3_ d.58.1.2 (3:) automated matches {Synechocystis sp. [TaxId: 1111708]}
shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay

Timeline for d6uzv3_:

• d6uzv3_ first appeared in SCOPe 2.07