Lineage for d6uzvh_ (6uzv h:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026161Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 3026162Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)
  6. 3026177Protein automated matches [347293] (1 species)
    not a true protein
  7. 3026178Species Synechocystis sp. [TaxId:1111708] [347294] (2 PDB entries)
  8. 3026181Domain d6uzvh_: 6uzv h: [392498]
    Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzv8_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvj_, d6uzvk_, d6uzvl_
    automated match to d1jb0i_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzvh_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (h:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6uzvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzvh_ f.23.17.1 (h:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdgsyaasylpwilipmvgwlfpavtmgllfihiese

SCOPe Domain Coordinates for d6uzvh_:

Click to download the PDB-style file with coordinates for d6uzvh_.
(The format of our PDB-style files is described here.)

Timeline for d6uzvh_: