Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) |
Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins) |
Protein automated matches [347293] (1 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347294] (2 PDB entries) |
Domain d6uzvh_: 6uzv h: [392498] Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzv8_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvj_, d6uzvk_, d6uzvl_ automated match to d1jb0i_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzvh_ f.23.17.1 (h:) automated matches {Synechocystis sp. [TaxId: 1111708]} mdgsyaasylpwilipmvgwlfpavtmgllfihiese
Timeline for d6uzvh_: