Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
Protein automated matches [254721] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries) |
Domain d6uiqa3: 6uiq A:305-421 [392382] Other proteins in same PDB: d6uiqa4, d6uiqa5, d6uiqb4, d6uiqb5 automated match to d5jn5a3 complexed with g6p, mg |
PDB Entry: 6uiq (more details), 2.3 Å
SCOPe Domain Sequences for d6uiqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uiqa3 c.84.1.0 (A:305-421) automated matches {Human (Homo sapiens) [TaxId: 9606]} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkyg
Timeline for d6uiqa3: