SCOPe 2.08: Domain d6uiqb1: 6uiq B:1-191

Lineage for d6uiqb1 (6uiq B:1-191)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.0: automated matches [254314] (1 protein)
   not a true family

6. Protein automated matches [254721] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries)

8. Domain d6uiqb1: 6uiq B:1-191 [392323]
   Other proteins in same PDB: d6uiqa4, d6uiqa5, d6uiqb4, d6uiqb5
   automated match to d5jn5a1
   complexed with g6p, mg

Details for d6uiqb1

PDB Entry: 6uiq, 2.3 Å

PDB Description: crystal structure of wild-type human phosphoglucomutase 1 in complex with glucose-6-phosphate

PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d6uiqb1:

Sequence; same for both SEQRES and ATOM records:

>d6uiqb1 c.84.1.0 (B:1-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
ggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
fkpftveivds

Timeline for d6uiqb1:

• d6uiqb1 first appeared in SCOPe 2.07