Lineage for d1ft8a2 (1ft8 A:118-199)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133613Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 133712Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 133713Protein mRNA export factor tap [54955] (1 species)
  7. 133714Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 133720Domain d1ft8a2: 1ft8 A:118-199 [39214]
    Other proteins in same PDB: d1ft8a1, d1ft8b1, d1ft8c1, d1ft8d1

Details for d1ft8a2

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1ft8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft8a2 d.58.7.2 (A:118-199) mRNA export factor tap {Human (Homo sapiens)}
nwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavny
kildrenrrisiiinssappht

SCOP Domain Coordinates for d1ft8a2:

Click to download the PDB-style file with coordinates for d1ft8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ft8a2: