SCOP 1.59: Domain d1ft8b1: 1ft8 B:

Lineage for d1ft8b1 (1ft8 B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)

4. Superfamily c.10.2: L domain-like [52058] (6 families)

5. Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
   this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain

6. Protein mRNA export factor tap [52066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)

8. Domain d1ft8b1: 1ft8 B: [30872]
   Other proteins in same PDB: d1ft8a2, d1ft8c2, d1ft8e1

Details for d1ft8b1

PDB Entry: 1ft8, 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1ft8b1:

Sequence; same for both SEQRES and ATOM records:

>d1ft8b1 c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens)}
elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiafdveap

Timeline for d1ft8b1:

• d1ft8b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ft8b1 appears in SCOP 1.57
  
• d1ft8b1 appears in SCOP 1.61
  
• d1ft8b1 appears in the current release, SCOPe 2.08, called d1ft8b_