Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) |
Superfamily c.10.2: L domain-like [52058] (6 families) |
Family c.10.2.3: mRNA export factor tap [52065] (1 protein) this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain |
Protein mRNA export factor tap [52066] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries) |
Domain d1ft8b1: 1ft8 B: [30872] Other proteins in same PDB: d1ft8a2, d1ft8c2, d1ft8e1 |
PDB Entry: 1ft8 (more details), 3.15 Å
SCOP Domain Sequences for d1ft8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft8b1 c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens)} elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl dgnslcdtfrdqstyisairerfpkllrldghelpppiafdveap
Timeline for d1ft8b1: