SCOPe 2.08: Domain d1ft8a2: 1ft8 A:118-199

Lineage for d1ft8a2 (1ft8 A:118-199)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)
Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
Protein mRNA export factor tap [54955] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
Domain d1ft8a2: 1ft8 A:118-199 [39214]
Other proteins in same PDB: d1ft8a1, d1ft8b_, d1ft8c1, d1ft8d_
chain E domain disordered

Details for d1ft8a2

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

PDB Compounds: (A:) tip associating protein

SCOPe Domain Sequences for d1ft8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft8a2 d.58.7.2 (A:118-199) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
nwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavny
kildrenrrisiiinssappht

SCOPe Domain Coordinates for d1ft8a2:

Click to download the PDB-style file with coordinates for d1ft8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ft8a2: