Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (13 proteins) |
Protein Splicesomal U1A protein [54932] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries) |
Domain d1cx0a_: 1cx0 A: [39158] |
PDB Entry: 1cx0 (more details), 2.3 Å
SCOP Domain Sequences for d1cx0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx0a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)} petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs satnalrsmqgfpfydkpmriqyaktdsdiiakma
Timeline for d1cx0a_: