PDB entry 1cx0

View 1cx0 on RCSB PDB site
Description: hepatitis delta virus ribozyme
Deposited on 1999-08-27, released 1999-09-08
The last revision prior to the SCOP 1.59 freeze date was dated 2000-06-26, with a file datestamp of 2000-06-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1cx0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cx0A (A:)
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakma