Lineage for d1cx0a_ (1cx0 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80286Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 80287Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 80361Protein Splicesomal U1A protein [54932] (1 species)
  7. 80362Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries)
  8. 80366Domain d1cx0a_: 1cx0 A: [39158]

Details for d1cx0a_

PDB Entry: 1cx0 (more details), 2.3 Å

PDB Description: hepatitis delta virus ribozyme

SCOP Domain Sequences for d1cx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx0a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakma

SCOP Domain Coordinates for d1cx0a_:

Click to download the PDB-style file with coordinates for d1cx0a_.
(The format of our PDB-style files is described here.)

Timeline for d1cx0a_: