Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (2 families) automatically mapped to Pfam PF01737 |
Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
Domain d6jllz_: 6jll Z: [390227] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_ automated match to d3a0hz_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d6jllz_: