Lineage for d6jllz_ (6jll Z:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629660Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 2629661Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2629662Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2629673Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 2629688Domain d6jllz_: 6jll Z: [390227]
    Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_
    automated match to d3a0hz_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jllz_

PDB Entry: 6jll (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset1)
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d6jllz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jllz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d6jllz_:

Click to download the PDB-style file with coordinates for d6jllz_.
(The format of our PDB-style files is described here.)

Timeline for d6jllz_: