Lineage for d6jllu_ (6jll u:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329767Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2329772Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2329784Domain d6jllu_: 6jll u: [390221]
    Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllv_, d6jllx_, d6jllz_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jllu_

PDB Entry: 6jll (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset1)
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d6jllu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jllu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d6jllu_:

Click to download the PDB-style file with coordinates for d6jllu_.
(The format of our PDB-style files is described here.)

Timeline for d6jllu_: