![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
![]() | Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries) |
![]() | Domain d6jllu_: 6jll u: [390221] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllv_, d6jllx_, d6jllz_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d6jllu_: