| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
| Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
| Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries) |
| Domain d6jllt_: 6jll t: [390231] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllu_, d6jllv_, d6jllx_, d6jllz_ automated match to d2axtt1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllt_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit
Timeline for d6jllt_: