Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein) |
Protein Ferredoxin [54871] (2 species) |
Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries) |
Domain d1frl__: 1frl - [38976] |
PDB Entry: 1frl (more details), 2.3 Å
SCOP Domain Sequences for d1frl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frl__ d.58.1.2 (-) Ferredoxin {Azotobacter vinelandii} afvvtdncikckytdcvevcpvdcfyegpnflvihpdscidcalcepecpaqaifsedev pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Timeline for d1frl__: