Lineage for d1frla_ (1frl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949081Protein Ferredoxin [54871] (3 species)
  7. 2949082Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 2949110Domain d1frla_: 1frl A: [38976]
    complexed with f3s, sf4

Details for d1frla_

PDB Entry: 1frl (more details), 2.3 Å

PDB Description: azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1frla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frla_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdscidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOPe Domain Coordinates for d1frla_:

Click to download the PDB-style file with coordinates for d1frla_.
(The format of our PDB-style files is described here.)

Timeline for d1frla_: