PDB entry 1frl

View 1frl on RCSB PDB site
Description: azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Deposited on 1993-09-27, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1frl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1frl_ (-)
  afvvtdncikckytdcvevcpvdcfyegpnflvihpdscidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler