Lineage for d6sbvd2 (6sbv D:161-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998826Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries)
  8. 2998976Domain d6sbvd2: 6sbv D:161-332 [387547]
    Other proteins in same PDB: d6sbva1, d6sbvb1, d6sbvc1, d6sbvd1, d6sbve1, d6sbvf1, d6sbvg1, d6sbvh1
    automated match to d4jnka2
    complexed with l5k

Details for d6sbvd2

PDB Entry: 6sbv (more details), 2.6 Å

PDB Description: x-ray structure of human ldh-a with an allosteric inhibitor (compound 7)
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6sbvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sbvd2 d.162.1.1 (D:161-332) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d6sbvd2:

Click to download the PDB-style file with coordinates for d6sbvd2.
(The format of our PDB-style files is described here.)

Timeline for d6sbvd2: