Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (20 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries) |
Domain d6sbvf2: 6sbv F:161-332 [387532] Other proteins in same PDB: d6sbva1, d6sbvb1, d6sbvc1, d6sbvd1, d6sbve1, d6sbvf1, d6sbvg1, d6sbvh1 automated match to d4jnka2 complexed with l5k |
PDB Entry: 6sbv (more details), 2.6 Å
SCOPe Domain Sequences for d6sbvf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sbvf2 d.162.1.1 (F:161-332) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf
Timeline for d6sbvf2: