SCOPe 2.08: Domain d6sbvh2: 6sbv H:161-332

Lineage for d6sbvh2 (6sbv H:161-332)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries)

8. Domain d6sbvh2: 6sbv H:161-332 [387675]
   Other proteins in same PDB: d6sbva1, d6sbvb1, d6sbvc1, d6sbvd1, d6sbve1, d6sbvf1, d6sbvg1, d6sbvh1
   automated match to d4jnka2
   complexed with l5k

Details for d6sbvh2

PDB Entry: 6sbv, 2.6 Å

PDB Description: x-ray structure of human ldh-a with an allosteric inhibitor (compound 7)

PDB Compounds: (H:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6sbvh2:

Sequence; same for both SEQRES and ATOM records:

>d6sbvh2 d.162.1.1 (H:161-332) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d6sbvh2:

• d6sbvh2 first appeared in SCOPe 2.07