Lineage for d6u1eb2 (6u1e B:115-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979226Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries)
  8. 2979244Domain d6u1eb2: 6u1e B:115-319 [385152]
    Other proteins in same PDB: d6u1ea1, d6u1ea3, d6u1ea4, d6u1eb1, d6u1eb3
    automated match to d2fb9a2
    complexed with atp, dal, mg, rb

Details for d6u1eb2

PDB Entry: 6u1e (more details), 2.1 Å

PDB Description: thermus thermophilus d-alanine-d-alanine ligase in complex with atp, d-alanine-d-alanine, mg2+ and rb+
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6u1eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u1eb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

SCOPe Domain Coordinates for d6u1eb2:

Click to download the PDB-style file with coordinates for d6u1eb2.
(The format of our PDB-style files is described here.)

Timeline for d6u1eb2: