Lineage for d2fb9a2 (2fb9 A:118-322)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979214Species Thermus caldophilus [TaxId:272] [225125] (1 PDB entry)
  8. 2979215Domain d2fb9a2: 2fb9 A:118-322 [204189]
    Other proteins in same PDB: d2fb9a1, d2fb9a3
    automated match to d1e4ea2

Details for d2fb9a2

PDB Entry: 2fb9 (more details), 1.9 Å

PDB Description: Crystal structure of the Apo form of D-alanine: D-alanine ligase (Ddl) from Thermus caldophilus: a basis for the substrate-induced conformational changes
PDB Compounds: (A:) D-alanine:D-alanine ligase

SCOPe Domain Sequences for d2fb9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb9a2 d.142.1.0 (A:118-322) automated matches {Thermus caldophilus [TaxId: 272]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

SCOPe Domain Coordinates for d2fb9a2:

Click to download the PDB-style file with coordinates for d2fb9a2.
(The format of our PDB-style files is described here.)

Timeline for d2fb9a2: