Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Thermus caldophilus [TaxId:272] [225124] (1 PDB entry) |
Domain d2fb9a1: 2fb9 A:4-117 [204188] Other proteins in same PDB: d2fb9a2, d2fb9a3 automated match to d1e4ea1 |
PDB Entry: 2fb9 (more details), 1.9 Å
SCOPe Domain Sequences for d2fb9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb9a1 c.30.1.0 (A:4-117) automated matches {Thermus caldophilus [TaxId: 272]} mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
Timeline for d2fb9a1: