Lineage for d2fb9a1 (2fb9 A:4-117)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862487Species Thermus caldophilus [TaxId:272] [225124] (1 PDB entry)
  8. 2862488Domain d2fb9a1: 2fb9 A:4-117 [204188]
    Other proteins in same PDB: d2fb9a2, d2fb9a3
    automated match to d1e4ea1

Details for d2fb9a1

PDB Entry: 2fb9 (more details), 1.9 Å

PDB Description: Crystal structure of the Apo form of D-alanine: D-alanine ligase (Ddl) from Thermus caldophilus: a basis for the substrate-induced conformational changes
PDB Compounds: (A:) D-alanine:D-alanine ligase

SCOPe Domain Sequences for d2fb9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb9a1 c.30.1.0 (A:4-117) automated matches {Thermus caldophilus [TaxId: 272]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

SCOPe Domain Coordinates for d2fb9a1:

Click to download the PDB-style file with coordinates for d2fb9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fb9a1: