Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (2 species) |
Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
Domain d1hnzs_: 1hnz S: [38453] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzt_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1hnzs_: