Lineage for d1hnzs_ (1hnz S:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) 
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) Protein Ribosomal protein S19 [54572] (1 species) Species Thermus thermophilus [TaxId:274] [54573] (8 PDB entries) 
Domain d1hnzs_: 1hnz S: [38453]
Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzt_, d1hnzv_
Details for d1hnzs_
PDB Entry: 1hnz (more details), 3.3 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
SCOP Domain Sequences for d1hnzs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
SCOP Domain Coordinates for d1hnzs_:
Click to download the PDB-style file with coordinates for d1hnzs_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnzs_:
- d1hnzs_ appears in SCOP 1.57
- d1hnzs_ appears in the current release, SCOPe 2.08
View in 3D
