SCOP 1.75: Domain d1hnze2: 1hnz E:5-73

Lineage for d1hnze2 (1hnz E:5-73)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
   Uniprot P27152

8. Domain d1hnze2: 1hnz E:5-73 [38791]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnze2

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1hnze2:

Sequence; same for both SEQRES and ATOM records:

>d1hnze2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d1hnze2:

• d1hnze2 first appeared (with stable ids) in SCOP 1.55
  
• d1hnze2 appears in SCOP 1.73
  
• d1hnze2 appears in SCOPe 2.01
  
• d1hnze2 appears in the current release, SCOPe 2.08