Lineage for d1hnzs_ (1hnz S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942145Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2942146Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2942147Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2942148Protein Ribosomal protein S19 [54572] (2 species)
  7. 2942176Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 2942184Domain d1hnzs_: 1hnz S: [38453]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzs_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1hnzs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1hnzs_:

Click to download the PDB-style file with coordinates for d1hnzs_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzs_: