SCOPe 2.08: Domain d1d5ma2: 1d5m A:4-81

Lineage for d1d5ma2 (1d5m A:4-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries)

8. Domain d1d5ma2: 1d5m A:4-81 [38191]
   Other proteins in same PDB: d1d5ma1, d1d5mb1, d1d5mb2, d1d5mc1, d1d5mc2
   complexed with nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1d5ma2

PDB Entry: 1d5m, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d5ma2:

Sequence; same for both SEQRES and ATOM records:

>d1d5ma2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d1d5ma2:

• d1d5ma2 first appeared (with stable ids) in SCOP 1.55
  
• d1d5ma2 appears in SCOPe 2.07