Lineage for d6rgzd_ (6rgz D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856142Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)
  8. 2856172Domain d6rgzd_: 6rgz D: [380991]
    Other proteins in same PDB: d6rgza1, d6rgza2, d6rgzb1, d6rgzb2
    automated match to d3dgec_
    complexed with adp, cl, mg, so4

Details for d6rgzd_

PDB Entry: 6rgz (more details), 2.35 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853-rr468 ph 6.5
PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d6rgzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rgzd_ c.23.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
ne

SCOPe Domain Coordinates for d6rgzd_:

Click to download the PDB-style file with coordinates for d6rgzd_.
(The format of our PDB-style files is described here.)

Timeline for d6rgzd_: