SCOPe 2.08: Domain d6rgzb2: 6rgz B:321-478

Lineage for d6rgzb2 (6rgz B:321-478)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein automated matches [190839] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [232020] (7 PDB entries)

8. Domain d6rgzb2: 6rgz B:321-478 [381029]
   Other proteins in same PDB: d6rgza1, d6rgzb1, d6rgzc_, d6rgzd_
   automated match to d2c2aa2
   complexed with adp, cl, mg, so4

Details for d6rgzb2

PDB Entry: 6rgz, 2.35 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853-rr468 ph 6.5

PDB Compounds: (B:) sensor histidine kinase

SCOPe Domain Sequences for d6rgzb2:

Sequence; same for both SEQRES and ATOM records:

>d6rgzb2 d.122.1.3 (B:321-478) automated matches {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipk

Timeline for d6rgzb2:

• d6rgzb2 first appeared in SCOPe 2.07