![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
![]() | Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54337] (5 PDB entries) |
![]() | Domain d1sxta2: 1sxt A:121-233 [37739] Other proteins in same PDB: d1sxta1, d1sxtb1 |
PDB Entry: 1sxt (more details), 2.7 Å
SCOP Domain Sequences for d1sxta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxta2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus} eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
Timeline for d1sxta2: