SCOP 1.55: Domain d1sxta2: 1sxt A:121-233

Lineage for d1sxta2 (1sxt A:121-233)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (4 PDB entries)

8. Domain d1sxta2: 1sxt A:121-233 [37739]
   Other proteins in same PDB: d1sxta1, d1sxtb1

Details for d1sxta2

PDB Entry: 1sxt, 2.7 Å

PDB Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc

SCOP Domain Sequences for d1sxta2:

Sequence; same for both SEQRES and ATOM records:

>d1sxta2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d1sxta2:

• d1sxta2 appears in SCOP 1.57
  
• d1sxta2 appears in the current release, SCOPe 2.08