Lineage for d1sxta1 (1sxt A:10-120)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 13930Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 13931Species Staphylococcus aureus [TaxId:1280] [50221] (4 PDB entries)
  8. 13936Domain d1sxta1: 1sxt A:10-120 [25150]
    Other proteins in same PDB: d1sxta2, d1sxtb2

Details for d1sxta1

PDB Entry: 1sxt (more details), 2.7 Å

PDB Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc

SCOP Domain Sequences for d1sxta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxta1 b.40.2.2 (A:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1sxta1:

Click to download the PDB-style file with coordinates for d1sxta1.
(The format of our PDB-style files is described here.)

Timeline for d1sxta1:

Domains from same chain:
(mouse over for more information)
d1sxta2
Domains from other chains:
(mouse over for more information)
d1sxtb1, d1sxtb2