Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Faecalibacterium prausnitzii [TaxId:853] [376258] (1 PDB entry) |
Domain d6u7ib2: 6u7i B:199-285 [376321] Other proteins in same PDB: d6u7ia1, d6u7ia3, d6u7ib1, d6u7ib3, d6u7ic1, d6u7ic3, d6u7id1, d6u7id3 automated match to d3hn3a2 |
PDB Entry: 6u7i (more details), 2.7 Å
SCOPe Domain Sequences for d6u7ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7ib2 b.1.4.0 (B:199-285) automated matches {Faecalibacterium prausnitzii [TaxId: 853]} eyiedvtivpavdgtvqyavkttgsapvrvtvldadgnavasaesaegtitipevhlwep rpgtpylytlhatcgadvydqtfgvrs
Timeline for d6u7ib2: