Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (7 proteins) |
Protein Elongin B [54246] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (3 PDB entries) |
Domain d1vcbd_: 1vcb D: [37604] Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_ |
PDB Entry: 1vcb (more details), 2.7 Å
SCOP Domain Sequences for d1vcbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcbd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens)} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppe
Timeline for d1vcbd_: