Lineage for d1vcbd_ (1vcb D:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.1: Ubiquitin-like [54236] (5 families) 
Family d.15.1.1: Ubiquitin-related [54237] (5 proteins) 
Protein Elongin B [54246] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54247] (1 PDB entry) 
Domain d1vcbd_: 1vcb D: [37604]
Other proteins in same PDB: d1vcbb_, d1vcbc_, d1vcbe_, d1vcbf_, d1vcbh_, d1vcbi_, d1vcbk_, d1vcbl_
Details for d1vcbd_
PDB Entry: 1vcb (more details), 2.7 Å
PDB Description: the vhl-elonginc-elonginb structure
SCOP Domain Sequences for d1vcbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcbd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens)}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppe
SCOP Domain Coordinates for d1vcbd_:
Click to download the PDB-style file with coordinates for d1vcbd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vcbd_:
- d1vcbd_ appears in SCOP 1.57
- d1vcbd_ appears in the current release, SCOPe 2.08
View in 3D
