SCOPe 2.08: Domain d6rvcf1: 6rvc F:6-123

Lineage for d6rvcf1 (6rvc F:6-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6rvcf1: 6rvc F:6-123 [375213]
   Other proteins in same PDB: d6rvcd2, d6rvcd3, d6rvce2, d6rvce3, d6rvcf2, d6rvcf3
   automated match to d5ocld_
   complexed with nag, so4

Details for d6rvcf1

PDB Entry: 6rvc, 2.2 Å

PDB Description: crystal structure of patched-1 ectodomain 2 (ptch1-ecd2) in complex with nanobody 75

PDB Compounds: (F:) Nanobody NB75

SCOPe Domain Sequences for d6rvcf1:

Sequence; same for both SEQRES and ATOM records:

>d6rvcf1 b.1.1.1 (F:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqagdsltlscaasgrtfssytmgwfrqapgkerdfiagitstgsstyyadsvk
grftisrdnakntvylqmnslkpedtadyycarkvaggsyyqkdkydywgqgtqvtvs

Timeline for d6rvcf1:

• d6rvcf1 first appeared in SCOPe 2.07