SCOPe 2.08: Domain d6reyk_: 6rey K:

Lineage for d6reyk_ (6rey K:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311421] (15 PDB entries)

8. Domain d6reyk_: 6rey K: [373846]
   Other proteins in same PDB: d6reya_, d6reyb_, d6reyc_, d6reyd_, d6reye_, d6reyf_, d6reyg_, d6reyi_, d6reyn_, d6reyo_, d6reyp_, d6reyq_, d6reyr_, d6reys_, d6reyt_, d6reyu_, d6reyw_
   automated match to d1iruk_
   complexed with ihp, k0w

Details for d6reyk_

PDB Entry: 6rey, 3 Å

PDB Description: human 20s-pa200 proteasome complex

PDB Compounds: (K:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6reyk_:

Sequence; same for both SEQRES and ATOM records:

>d6reyk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
riidkngihdldnisf

Timeline for d6reyk_:

• d6reyk_ first appeared in SCOPe 2.07