Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [311421] (15 PDB entries) |
Domain d6reym_: 6rey M: [373844] Other proteins in same PDB: d6reya_, d6reyb_, d6reyc_, d6reyd_, d6reye_, d6reyf_, d6reyg_, d6reyi_, d6reyn_, d6reyo_, d6reyp_, d6reyq_, d6reyr_, d6reys_, d6reyt_, d6reyu_, d6reyw_ automated match to d1iru1_ complexed with ihp, k0w |
PDB Entry: 6rey (more details), 3 Å
SCOPe Domain Sequences for d6reym_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6reym_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]} rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi saaerdvytgdalricivtkegireetvslrkd
Timeline for d6reym_: