Lineage for d6reym_ (6rey M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993109Species Human (Homo sapiens) [TaxId:9606] [311421] (15 PDB entries)
  8. 2993171Domain d6reym_: 6rey M: [373844]
    Other proteins in same PDB: d6reya_, d6reyb_, d6reyc_, d6reyd_, d6reye_, d6reyf_, d6reyg_, d6reyi_, d6reyn_, d6reyo_, d6reyp_, d6reyq_, d6reyr_, d6reys_, d6reyt_, d6reyu_, d6reyw_
    automated match to d1iru1_
    complexed with ihp, k0w

Details for d6reym_

PDB Entry: 6rey (more details), 3 Å

PDB Description: human 20s-pa200 proteasome complex
PDB Compounds: (M:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d6reym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6reym_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
saaerdvytgdalricivtkegireetvslrkd

SCOPe Domain Coordinates for d6reym_:

Click to download the PDB-style file with coordinates for d6reym_.
(The format of our PDB-style files is described here.)

Timeline for d6reym_: